USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Desert Terrain Set
2 product(s) found for "Desert Terrain Set"
Desert Terrain Set - Large
Desert Terrain Set
Desert Terrain Set - Large
Can you feel the heat? This meticulously detailed terrain will scortch your table. While you sit cozy in your nice air conditioning, your army will be melting under a brutal sun in this rocky, dusty environment....
$400.00
Units in Stock: 999
$400.00
Details
Add To Cart
Can you feel the heat? This meticulously detailed terrain will scortch your table. While you sit cozy in your nice air conditioning, your army will be melting under a brutal sun in this rocky, dusty environment....
Desert Terrain Set - Small
Desert Terrain Set
Desert Terrain Set - Small
Can you feel the heat? This meticulously detailed terrain will scortch your table. While you sit cozy in your nice air conditioning, your army will be melting under a brutal sun in this rocky, dusty environment....
$225.00
Units in Stock: 999
$225.00
Details
Add To Cart
Can you feel the heat? This meticulously detailed terrain will scortch your table. While you sit cozy in your nice air conditioning, your army will be melting under a brutal sun in this rocky, dusty environment....
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i