USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Ice Terrain Set
2 product(s) found for "Ice Terrain Set"
Ice Terrain Set - Large
Ice Terrain Set
Ice Terrain Set - Large
FREEZE! Hold it right there! The tundra is a harsh place to be in times of war. While this amazing set may make you smile warmly, your soldiers on the table won't be enjoying any of that. Sharp crags of...
$350.00
Units in Stock: 999
$350.00
Details
Add To Cart
FREEZE! Hold it right there! The tundra is a harsh place to be in times of war. While this amazing set may make you smile warmly, your soldiers on the table won't be enjoying any of that. Sharp crags of...
Ice Terrain Set - Small
Ice Terrain Set
Ice Terrain Set - Small
FREEZE! Hold it right there! The tundra is a harsh place to be in times of war. While this amazing set may make you smile warmly, your soldiers on the table won't be enjoying any of that. Sharp crags of...
$200.00
Units in Stock: 999
$200.00
Details
Add To Cart
FREEZE! Hold it right there! The tundra is a harsh place to be in times of war. While this amazing set may make you smile warmly, your soldiers on the table won't be enjoying any of that. Sharp crags of...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i